Free Shipping Canada-Wide On Orders Over $300. Quality Assured. 

IGF-1LR3
$94.99
IGF-1 LR3 is primarily researched for insulin-like growth factor signalling, growth and survival pathways, and cellular metabolism.
Research reagent studied in controlled laboratory settings. For laboratory and educational research only, not for human or therapeutic use.
This product is prepared for laboratory research use only and may not be used for other purposes. All compounds are supplied in sealed research vials.
IGF-1 LR3 is a modified analogue of insulin-like growth factor-1 containing an extended N-terminal sequence and an arginine substitution. It is used in experimental research involving IGF receptor signalling, cellular proliferation, protein synthesis, and metabolic pathways. The modified structure provides researchers with a defined molecular system for studying IGF-related signalling and downstream cellular responses.
| Size | 0.1mg, 1mg |
|---|---|
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9117.6 g/mol |
| Purity | 99%+ |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKSA |