IGF-1LR3

$94.99

IGF-1 LR3 is primarily researched for insulin-like growth factor signalling, growth and survival pathways, and cellular metabolism.

Certificate of Analysis

SKU: N/A Categories: ,

Research reagent studied in controlled laboratory settings. For laboratory and educational research only, not for human or therapeutic use.

This product is prepared for laboratory research use only and may not be used for other purposes. All compounds are supplied in sealed research vials.

IGF-1 LR3 is a modified analogue of insulin-like growth factor-1 containing an extended N-terminal sequence and an arginine substitution. It is used in experimental research involving IGF receptor signalling, cellular proliferation, protein synthesis, and metabolic pathways. The modified structure provides researchers with a defined molecular system for studying IGF-related signalling and downstream cellular responses.

Size

0.1mg, 1mg

Molecular Formula

C400H625N111O115S9

Molecular Weight

9117.6 g/mol

Purity

99%+

Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKSA

First Order? Save 10%

Subscribe for 10% off your first order, plus product updates, research resources, and exclusive PremierPeptides™ offers.